EnglishUSDPatPat Image United States
EnglishعربىPortuguêsEspañolitalianoDeutschFrench繁體中文
USDEURGBPAUDMVRNGNBDTBRLCADDKKEGPHKDINRIDRILSJPYJODKWDMYRMXNNZDNOKOMRPHPPLNQARRUBSARSGDLKRSEKTHBUAHAEDBHDBOBCOPCRCDOPGTQHNLKZTLBPMOPMADPKRPYGPENKRWCHFTWDTNDVEFVND

SHIPPING TO

United States Germany United Kingdom Australia Maldives Nigeria Argentina Austria Bangladesh Belarus Belgium Brazil Bulgaria Canada Canary Islands Croatia Cyprus Czech Republic Denmark Egypt Estonia Faroe Islands Finland France Greece Greenland Hong Kong Hungary India Indonesia Ireland Israel Italy Japan Jordan Kuwait Latvia Lithuania Luxembourg Malaysia Malta Mexico Netherlands New Zealand Norway Oman Philippines Poland Portugal Qatar Romania Russian Federation Saudi Arabia Serbia Singapore Spain Sri Lanka Sweden Thailand Ukraine United Arab Emirates Albania Algeria Andorra Armenia Azerbaijan Bahrain Bolivia Chile China Colombia Costa Rica Dominican Republic Ecuador French Guiana Georgia Guadeloupe Guatemala Honduras Iceland Kazakhstan Kosovo Lebanon Liechtenstein Macao Macedonia Martinique Mauritius Moldova Monaco Montenegro Morocco Pakistan Panama Paraguay Peru Reunion San Marino Slovakia Slovenia South Africa South Korea Switzerland Taiwan Tunisia Turkey Venezuela Vietnam
FREE SHIPPING on orders over $35.00
Cash on Delivery

Cash on delivery (COD) is available for Hong Kong, Taiwan, Thailand, Singapore, Malaysia, Bahrain, Qatar, Saudi Arabia, Oman, Kuwait and United Arab Emirates.

Order StatusFAQs

Spring and summer hamster chinchilla ferret breathable mesh hammock

Price

Old price$11.99

$2.99- 75%

Clearance

Color
Size
Qty
-
+
StatusOnly 5 left
57 liked
norton

Description

*Size: S 15 * 15 / M 33 * 30 CM

*Material: Fresh and breathable mesh cloth. Cool in summer, comfortable in texture, ventilated and ventilated, not off-line pilling, easy to clean, integrating leisure, sleep and entertainment, blue + pink + yellow, multi-color options.

*Design: using stainless steel metal buckle, strong bearing capacity. It has no pressure on load-bearing rabbits, turtles and other animals, is resistant to corrosion, is not easily damaged, and has a long service life. The interior uses a unique hollow leak design, and the residue of pets or feces will fall off on its own, which is easy to clean and not easy to reproduce bacteria.

*Multifunctional: Suitable for small animals such as hamsters, mice, rats, gliders, squirrels, squirrels, guinea pigs, etc.

*Machine wash, tumble dry

*Imported

Return Policy

100% Secured Payments

Highest Quality Guarantee
PatPat guarantees you only quality merchandise.